.
The Open Protein Structure Annotation Network
PDB Keyword
.

1j2w

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of aldolase from Thermus thermophilus HB8 showing the contribution of oligomeric state to thermostability. Acta Crystallogr.,Sect.D 60 1816-1823 2004
    Site RSGI
    PDB Id 1j2w Target Id ttk003000501.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14390, Molecular Weight 23305.43 Da.
    Residues 220 Isoelectric Point 5.87
    Sequence mdlaahidhtllkptatleevakaaeealeygfyglcippsyvawvraryphapfrlvtvvgfplgyqe kevkaleaalacargadevdmvlhlgrakagdldyleaevravreavpqavlkviletgyfspeeiarl aeaairggadflktstgfgprgasledvallvrvaqgraqvkaaggirdretalrmlkagasrlgtssg valvageggtlgy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.50 Rfree 0.213
    Matthews' coefficent 2.27 Rfactor 0.197
    Waters 481 Solvent Content 45.34

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1j2w

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch