The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis of replication origin recognition by the DnaA protein. NUCLEIC ACIDS RES. 31 2077-2086 2003
    Site RSGI
    PDB Id 1j1v Target Id trt001000145.1
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS14084, Molecular Weight 10677.56 Da.
    Residues 94 Isoelectric Point 9.25
    Sequence vtidniqktvaeyykikvadllskrrsrsvarprqxaxalakeltnhslpeigdafggrdhttvlhacr kieqlreeshdikedfsnlirtlss
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.2489
    Matthews' coefficent 2.53 Rfactor 0.2292
    Waters 143 Solvent Content 51.04

    Ligand Information


    Google Scholar output for 1j1v

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch