.
The Open Protein Structure Annotation Network
PDB Keyword
.

1j1u

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis for orthogonal tRNA specificities of tyrosyl-tRNA synthetases for genetic code expansion. NAT.STRUCT.BIOL. 10 425-432 2003
    Site RSGI
    PDB Id 1j1u Target Id my_001000009.1
    Molecular Characteristics
    Source Methanocaldococcus jannaschii
    Alias Ids TPS13669, Molecular Weight 35046.94 Da.
    Residues 306 Isoelectric Point 6.23
    Sequence mdefemikrntseiiseeelrevlkkdeksayigfepsgkihlghylqikkmidlqnagfdiiilladl haylnqkgeldeirkigdynkkvfeamglkakyvygsefqldkdytlnvyrlalkttlkrarrsmelia redenpkvaeviypimqvndihylgvdvavggmeqrkihmlarellpkkvvcihnpvltgldgegkmss skgnfiavddspeeirakikkaycpagvvegnpimeiakyfleypltikrpekfggdltvnsyeelesl fknkelhpmdlknavaeelikilepirkrl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.95 Rfree 0.239
    Matthews' coefficent 2.76 Rfactor 0.188
    Waters 364 Solvent Content 55.11

    Ligand Information
    Ligands TYR x 1
    Metals MG (MAGNESIUM) x 4

    Jmol

     
    Google Scholar output for 1j1u

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch