The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title ATP binding by glutamyl-tRNA synthetase is switched to the productive mode by tRNA binding. EMBO J. 22 676-688 2003
    Site RSGI
    PDB Id 1j09 Target Id ttk003000897.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14484, Molecular Weight 53906.93 Da.
    Residues 468 Isoelectric Point 6.53
    Sequence mvvtriapsptgdphvgtayialfnyawarrnggrfivriedtdraryvpgaeerilaalkwlglsyde gpdvggphgpyrqserlplyqkyaeellkrgwayrafetpeeleqirkekggydgrarnippeeaeera rrgephvirlkvprpgttevkdelrgvvvydnqeipdvvllksdgyptyhlanvvddhlmgvtdvirae ewlvstpihvllyrafgweaprfyhmpllrnpdktkiskrkshtsldwykaegflpealrnylclmgfs mpdgreiftleefiqaftwervslggpvfdleklrwmngkyirevlsleevaervkpflreaglswese aylrravelmrprfdtlkefpekarylftedypvsekaqrkleeglpllkelyprlraqeewteaalea llrgfaaekgvklgqvaqplraaltgsletpglfeilallgkeralrrlerala
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.227
    Matthews' coefficent 2.39 Rfactor 0.199
    Waters 355 Solvent Content 48.04

    Ligand Information
    Metals MG (MAGNESIUM) x 1


    Google Scholar output for 1j09

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch