The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of an Arabidopsis homologue of the mammalian membrane-associated progesterone receptor. To be Published
    Site RSGI
    PDB Id 1j03 Target Id atr001011428.1
    Molecular Characteristics
    Source Arabidopsis thaliana
    Alias Ids TPS12257, Molecular Weight 11030.70 Da.
    Residues 100 Isoelectric Point 4.81
    Sequence meftaeqlsqyngtdeskpiyvaikgrvfdvttgksfygsggdysmfagkdasralgkmskneedvsps legltekeintlndwetkfeakypvvgrvvs
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1j03

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch