The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of RSGI RUH-001, a Fis1p-like and CGI-135 homologous domain from a mouse cDNA. To be Published
    Site RSGI
    PDB Id 1iyg Target Id mmk001005263.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13455, Molecular Weight 14112.44 Da.
    Residues 120 Isoelectric Point 7.74
    Sequence meavlnelvsvedlknferkfqseqaagsvskstqfeyawclvrskynedirrgivlleellpkgskee qrdyvfylavgnyrlkeyekalkyvrgllqtepqnnqakelerlidkamkk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1iyg

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch