.
The Open Protein Structure Annotation Network
PDB Keyword
.

1iyf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Parkin binds the Rpn10 subunit of 26S proteasomes through its ubiquitin-like domain. EMBO REP. 4 301-306 2003
    Site RSGI
    PDB Id 1iyf Target Id my_001000012.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13675, Molecular Weight 9235.12 Da.
    Residues 81 Isoelectric Point 8.17
    Sequence gplgsmivfvrfnsshgfpvevdsdtsifqlkevvakrqgvpadqlrvifagkelrndwtvqncdldqq sivhivqrpwrk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1iyf

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch