.
The Open Protein Structure Annotation Network
PDB Keyword
.

1iwk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Infrared spectroscopic and mutational studies on putidaredoxin-induced conformational changes in ferrous CO-P450cam. Biochemistry 42 14507-14514 2003
    Site RSGI
    PDB Id 1iwk Target Id my_001000035.1
    Molecular Characteristics
    Source Pseudomonas putida
    Alias Ids TPS13710, Molecular Weight 46638.72 Da.
    Residues 415 Isoelectric Point 5.24
    Sequence mttetiqsnanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrg qlireayedyrhfssecpfipreageaydfiptsmdppeqrqfkalanqvvgmpvvdklenriqelacs lieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdgsmtfaeakealydylip iieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvggldtvvnflsfsmeflakspehrqeli erperipaaceellrrfslvadgriltsdyefhgvqlkkgdqillpqmlsglderenacpmhvdfsrqk vshttfghgshlclgqhlarreiivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.235
    Matthews' coefficent 2.21 Rfactor 0.181
    Waters 163 Solvent Content 44.32

    Ligand Information
    Ligands HEM (PROTOPORPHYRIN) x 1
    Metals

    Jmol

     
    Google Scholar output for 1iwk

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch