The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Infrared spectroscopic and mutational studies on putidaredoxin-induced conformational changes in ferrous CO-P450cam. Biochemistry 42 14507-14514 2003
    Site RSGI
    PDB Id 1iwi Target Id my_001000033.1
    Molecular Characteristics
    Source Pseudomonas putida
    Alias Ids TPS13708, Molecular Weight 46666.73 Da.
    Residues 415 Isoelectric Point 5.24
    Sequence mttetiqsnanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrg qlireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklenriqelacs lieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdgsmtfaeakealydylip iieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvggldtvvnflsfsmeflakspehrqeli erperipaaceellrrfslvadgriltsdyefhgvqlkkgdqillpqmlsglderenacpmhvdfsrqk vshttfghgshlclgqhlarreiivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.182
    Matthews' coefficent 2.20 Rfactor 0.177
    Waters 126 Solvent Content 44.18

    Ligand Information


    Google Scholar output for 1iwi

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch