.
The Open Protein Structure Annotation Network
PDB Keyword
.

1iw9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the M intermediate of bacteriorhodopsin: allosteric structural changes mediated by sliding movement of a transmembrane helix. J.Mol.Biol. 341 1023-1037 2004
    Site RSGI
    PDB Id 1iw9 Target Id my_001000028.3
    Molecular Characteristics
    Source Halobacterium salinarum
    Alias Ids TPS13700, Molecular Weight 26799.05 Da.
    Residues 248 Isoelectric Point 4.83
    Sequence qaqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgygltmv pfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglvgaltkvysyrfvww aistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsaypvvwligsegagivplnietll fmvldvsakvgfglillrsraifgeaeapepsagdgaaats
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.271
    Matthews' coefficent 3.16 Rfactor 0.224
    Waters 25 Solvent Content 61.11

    Ligand Information
    Ligands GLC-MAN-GAL (ALPHA-D-GLUCOSE) x 1;RET (ALPHA-D-MANNOSE) x 1;L3P (BETA-D-GALACTOSE) x 4;L2P (RETINAL) x 1
    Metals

    Jmol

     
    Google Scholar output for 1iw9

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch