The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a bacterial RNA polymerase holoenzyme at 2.6 A resolution. NATURE 417 712-719 2002
    Site RSGI
    PDB Id 1iw7 Target Id ttk003000791.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14427, Molecular Weight 48521.48 Da.
    Residues 423 Isoelectric Point 5.06
    Sequence mkkskrknaqaqeaqetevlvqeeaeelpefpegepdpdledpdltleddlldlpeegegldleeeeed lpipkistsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvrakilgs arvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlrlvvsiakkytgrgl sfldliqegnqgliravekfeykrrfkfstyatwwirqainraiadqartiripvhmvetinklsrtar qlqqelgreptyeeiaeamgpgwdakrveetlkiaqepvsletpigdekdsfygdfipdehlpspvdaa tqsllseelekalsklsereamvlklrkglidgrehtleevgaffgvtrerirqienkalrklkyhesr trklrdfld
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.60 Rfree 0.2740000
    Matthews' coefficent Rfactor 0.2280000
    Waters 5476 Solvent Content

    Ligand Information
    Metals MG (MAGNESIUM) x 485;PB (LEAD) x 4


    Google Scholar output for 1iw7

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch