The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Specific Damage Induced by X-ray Radiation and Structural Changes in the Primary Photoreaction of Bacteriorhodopsin. J.Mol.Biol. 324 469-481 2002
    Site RSGI
    PDB Id 1iw6 Target Id my_001000028.1
    Molecular Characteristics
    Source Halobacterium salinarum
    Alias Ids TPS13698, Molecular Weight 26799.05 Da.
    Residues 248 Isoelectric Point 4.83
    Sequence qaqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgygltmv pfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglvgaltkvysyrfvww aistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsaypvvwligsegagivplnietll fmvldvsakvgfglillrsraifgeaeapepsagdgaaats
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.275
    Matthews' coefficent 3.16 Rfactor 0.251
    Waters 41 Solvent Content 61.10

    Ligand Information


    Google Scholar output for 1iw6

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch