The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structures of the ferric and ferrous forms of the heme complex of HmuO, a heme oxygenase of Corynebacterium diphtheriae. J.Biol.Chem. 279 11937-11947 2004
    Site RSGI
    PDB Id 1iw1 Target Id my_001000032.2
    Molecular Characteristics
    Source Corynebacterium diphtheriae
    Alias Ids TPS13707, Molecular Weight 24136.89 Da.
    Residues 215 Isoelectric Point 5.38
    Sequence mttataglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavrasgfa eslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpalvahhyvrylgdls ggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlelsdeqrehllkeatdafvfnhqv fadlgkgl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.50 Rfree 0.202
    Matthews' coefficent 2.49 Rfactor 0.177
    Waters 584 Solvent Content 50.29

    Ligand Information


    Google Scholar output for 1iw1

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch