.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ivz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the SEA domain from the murine homologue of ovarian cancer antigen CA125 (MUC16). J.Biol.Chem. 279 13174-13182 2004
    Site RSGI
    PDB Id 1ivz Target Id mmt007010579.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13521, Molecular Weight 13660.48 Da.
    Residues 119 Isoelectric Point 9.10
    Sequence ssssqhfnlnftitnlpysqdiaqpsttkyqqtkrsienalnqlfrnssiksyfsdcqvlafrsvsnnn nhtgvdslcnfsplarrvdrvaiyeeflrmthngtqllnftldrksvfvd
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ivz

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch