The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the YqgF-family protein (N-terminal fragment). To be published
    Site RSGI
    PDB Id 1iv0 Target Id ttk003001690.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14778, Molecular Weight 14892.53 Da.
    Residues 135 Isoelectric Point 7.99
    Sequence mrvgaldvgeariglavgeegvplasgrgylvrktleedvealldfvrreglgklvvglplrtdlkesa qagkvlplvealrargvevelwderfttklaqerlkhapkrlrrdkgkldelaavvlledylargi
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1iv0

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch