The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the cullin-3 homologue. To be published
    Site RSGI
    PDB Id 1iuy Target Id mmk001000556.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13422, Molecular Weight 10789.00 Da.
    Residues 92 Isoelectric Point 9.74
    Sequence maakqgesdperketrqkvdddrkheieaaivrimksrkkmqhnvlvaevtqqlkarflpspvvikkri egliereylartpedrkvytyva
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1iuy

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch