The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a conserved CoA-binding protein synthesized by a cell-free system. Acta Crystallogr.,Sect.D 59 1213-1218 2003
    Site RSGI
    PDB Id 1iul Target Id ttk003001466.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14728, Molecular Weight 15865.61 Da.
    Residues 140 Isoelectric Point 6.52
    Sequence mndqelraylsqaktiavlgahkdpsrpahyvprylreqgyrvlpvnprfqgeelfgeeavaslldlke pvdildvfrppsalmdhlpevlalrpglvwlqsgirhpefekalkeagipvvadrclmvehkrlfrgpl pl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.27
    Matthews' coefficent 1.93 Rfactor 0.187
    Waters 121 Solvent Content 35.66

    Ligand Information


    Google Scholar output for 1iul

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch