The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Fucose-Specific Lectin from Aleuria aurantia Binding Ligands at Three of Its Five Sugar Recognition Sites. Biochemistry 42 11093-11099 2003
    Site RSGI
    PDB Id 1iuc Target Id my_001000040.1
    Molecular Characteristics
    Source Aleuria aurantia
    Alias Ids TPS13716, Molecular Weight 33396.40 Da.
    Residues 312 Isoelectric Point 9.33
    Sequence pteflytskiaaiswaatggrqqrvyfqdlngkireaqrggdnpwtggssqnvigeaklfsplaavtwk saqgiqirvycvnkdnilsefvydgskwitgqlgsvgvkvgsnsklaalqwggsesappnirvyyqksn gsgssiheyvwsgkwtagasfgstvpgtgigataigpgrlriyyqatdnkirehcwdsnswyvggfsas asagvsiaaiswgstpnirvywqkgreelyeaayggswntpgqikdasrptpslpdtfiaanssgnidi svffqasgvslqqwqwisgkgwsigavvptgtpagw
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.24 Rfree 0.196
    Matthews' coefficent 3.81 Rfactor 0.164
    Waters 169 Solvent Content 67.72

    Ligand Information
    Ligands FUL (BETA-L-FUCOSE) x 2;FUC (ALPHA-L-FUCOSE) x 1;SO4 (SULFATE) x 1


    Google Scholar output for 1iuc

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch