.
The Open Protein Structure Annotation Network
PDB Keyword
.

1it8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of archaeosine tRNA-guanine transglycosylase. J.Mol.Biol. 318 665-677 2002
    Site RSGI
    PDB Id 1it8 Target Id trt001000258.3
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS14120, Molecular Weight 66592.51 Da.
    Residues 582 Isoelectric Point 8.79
    Sequence msrgdkmlkfeikardgagrigklevngkkietpaimpvvnpkqmvvepkelekmgfeiiitnsyiiyk deelrrkalelgihrmldyngiievdsgsfqlmkygsievsnreiiefqhrigvdigtfldiptppdap reqavkeleitlsrareaeeikeipmnatiqgstytdlrryaarrlssmnfeihpiggvvpllesyrfr dvvdivisskmalrpdrpvhlfgaghpivfalavamgvdlfdsasyalyakddrymtpegtkrldeldy fpcscpvcskytpqelrempkeertrllalhnlwvikeeikrvkqaikegelwrlvderarshpklysa ykrllehytfleefepitkksalfkisneslrwpvvrrakeraksinerfgelvehpifgrvsrylslt ypfaqseaeddfkiekptkedaikyvmaiaeyqfgegasrafddakvelsktgmprqvkvngkrlatvr addglltlgiegakrlhrvlpyprmrvvvnkeaepfarkgkdvfakfvifadpgirpydevlvvnende llatgqallsgremivfqygravkvrkgve
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.2780000
    Matthews' coefficent 3.46 Rfactor 0.2320000
    Waters 142 Solvent Content 64.47

    Ligand Information
    Ligands PQ0 (2-AMINO-4-OXO-4,7-DIHYDRO-3H-PYRROLO[2,3-D]PYRIMIDINE-) x 1
    Metals MG (MAGNESIUM) x 2;ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 1it8

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch