The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Functional convergence of two lysyl-tRNA synthetases with unrelated topologies. Nat.Struct.Biol. 9 257-262 2002
    Site RSGI
    PDB Id 1irx Target Id trt001000216.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS14109, Molecular Weight 61556.39 Da.
    Residues 523 Isoelectric Point 5.88
    Sequence mvhwadyiadkiirergekekyvvesgitpsgyvhvgnfrelftayivghalrdkgyevrhihmwddyd rfrkvprnvpqewkdylgmpisevpdpwgchesyaehfmrkfeeeveklgievdllyaselykrgeyse eirlafekrdkimeilnkyreiakqpplpenwwpamvycpehrreaeiiewdggwkvkykcpeghegwv dirsgnvklrwrvdwpmrwshfgvdfepagkdhlvagssydtgkeiikevygkeaplslmyefvgikgq kgkmsgskgnvillsdlyevlepglvrfiyarhrpnkeikidlglgilnlydefekveriyfgveggkg ddeelrrtyelsmpkkperlvaqapfrflavlvqlphlteediinvlikqghiprdlskedvervklri nlarnwvkkyapedvkfsilekppevevsedvreamnevaewlenheefsveefnnilfevakrrgiss rewfstlyrlfigkergprlasflasldrsfvikrlrleg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.60 Rfree 0.2920000
    Matthews' coefficent 2.80 Rfactor 0.2250000
    Waters 248 Solvent Content 56.12

    Ligand Information
    Metals ZN (ZINC) x 4


    Google Scholar output for 1irx

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch