.
The Open Protein Structure Annotation Network
PDB Keyword
.

1iqr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of thermostable DNA photolyase: pyrimidine-dimer recognition mechanism. Proc.Natl.Acad.Sci.USA 98 13560-13565 2001
    Site RSGI
    PDB Id 1iqr Target Id ttk003000732.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14423, Molecular Weight 47898.36 Da.
    Residues 420 Isoelectric Point 9.36
    Sequence mgpllvwhrgdlrlhdhpallealargpvvglvvldpnnlkttprrrawflenvralreayrarggalw vleglpwekvpeaarrlkakavyaltshtpygryrdgrvrealpvplhllpaphllppdlprayrvytp fsrlyrgaapplpppealpkgpeegeipredpglplpepgeeaalaglrafleaklpryaeerdrldge ggsrlspyfalgvlsprlaaweaerrggegarkwvaellwrdfsyhllyhfpwmaerpldprfqafpwq edealfqawyegktgvplvdaamrelhatgflsnrarmnaaqfavkhlllpwkrceeafrhllldgdra vnlqgwqwagglgvdaapyfrvfnpvlqgerhdpegrwlkrwapeypsyapkdpvvdleearrrylrla rdlarg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.2510000
    Matthews' coefficent 2.73 Rfactor 0.2140000
    Waters 73 Solvent Content 54.98

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1;FAD (FLAVIN-ADENINE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1iqr

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch