.
The Open Protein Structure Annotation Network
PDB Keyword
.

1iq0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural and mutational studies of the recognition of the arginine tRNA-specific major identity element, A20, by arginyl-tRNA synthetase. Proc.Natl.Acad.Sci.USA 98 13537-13542 2001
    Site RSGI
    PDB Id 1iq0 Target Id ttk003000886.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14479, Molecular Weight 66223.25 Da.
    Residues 592 Isoelectric Point 6.04
    Sequence mlrraleeaiaqalkemgvpvrlkvarapkdkpgdygvplfalakelrkppqaiaqelkdrlplpefve eavpvggylnfrlrteallrealrpkapfprrpgvvlvehtsvnpnkelhvghlrnialgdaiarilay agrevlvlnyiddtgrqaaetlfalrhygltwdgkekydhfagrayvrlhqdpeyerlqpaieevlhal ergelreevnrillaqmatmhalnarydllvwesdivragllqkalalleqsphvfrpregkyagalvm daspvipgledpffvllrsngtatyyakdiafqfwkmgileglrfrpyenpyypglrtsapegeaytpk aeetinvvdvrqshpqalvraalalagypalaekahhlayetvllegrqmsgrkglavsvdevleeatr raraiveeknpdhpdkeeaarmvalgairfsmvktepkkqidfryqealsfegdtgpyvqyaharahsi lrkagewgapdlsqatpyeralaldlldfeeavleaaeertphvlaqylldlaaswnayynarengqpa tpvltapeglrelrlslvqslqrtlatgldllgipapevm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.2420000
    Matthews' coefficent 4.41 Rfactor 0.2150000
    Waters 196 Solvent Content 72.08

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1iq0

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch