.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ipa

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title An enzyme with a deep trefoil knot for the active-site architecture. Acta Crystallogr.,Sect.D 58 1129-1137 2002
    Site RSGI
    PDB Id 1ipa Target Id ttk003000899.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14492, Molecular Weight 29978.77 Da.
    Residues 274 Isoelectric Point 6.56
    Sequence mritstanprikelarllerkhrdsqrrfliegareieralqagieleqalvwegglnpeeqqvyaalg rvgrlallevseavlkklsvrdnpaglialarmpertleeyrpspdalilvavglekpgnlgavlrsad aagaeavlvaggvdlyspqvirnstgvvfslrtlaasesevldwikqhnlplvattphaealyweanlr ppvaiavgpeheglraawleaaqtqvripmqgqadslnvsvsaalllyealrqrllrdrltkthstl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.2860000
    Matthews' coefficent 2.33 Rfactor 0.2260000
    Waters 151 Solvent Content 47.20

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ipa

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch