.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ioz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Selenomethionine incorporation into a protein by cell-free synthesis. J.STRUCT.FUNCT.GENOM. 2 29-35 2001
    Site RSGI
    PDB Id 1ioz Target Id trt001000212.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS14105, Molecular Weight 19491.07 Da.
    Residues 171 Isoelectric Point 5.27
    Sequence mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtagqeeysamrd qymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdlaartvesrqaqdlarsyg ipyietsaktrqgvedafytlvreirqhklrkl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.2830000
    Matthews' coefficent 2.60 Rfactor 0.2380000
    Waters 180 Solvent Content 52.62

    Ligand Information
    Ligands GDP (GUANOSINE-5'-DIPHOSPHATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1ioz

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch