The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Thermophilic cytochrome P450 (CYP119) from Sulfolobus solfataricus: high resolution structure and functional properties. J.Inorg.Biochem. 91 491-501 2002
    Site RSGI
    PDB Id 1io7 Target Id ar_001000512.1
    Molecular Characteristics
    Source Sulfolobus solfataricus
    Alias Ids TPS12183, Molecular Weight 42860.80 Da.
    Residues 368 Isoelectric Point 6.09
    Sequence mydwfsemrkkdpvyydgniwqvfsyrytkevlnnfskfssdltgyherledlrngkirfdiptrytml tsdpplhdelrsmsadifspqklqtletfirettrslldsidpreddivkklavplpiiviskilglpi edkekfkewsdlvafrlgkpgeifelgkkyleligyvkdhlnsgtevvsrvvnsnlsdieklgyiilll iagnetttnlisnsvidftrfnlwqrireenlylkaieealrysppvmrtvrktkervklgdqtieege yvrvwiasanrdeevfhdgekfipdrnpnphlsfgsgihlclgaplarleariaieefskrfrhieild tekvpnevlngykrlvvrlksne
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.50 Rfree 0.2670000
    Matthews' coefficent 2.40 Rfactor 0.2240000
    Waters 476 Solvent Content 48.67

    Ligand Information
    Ligands HEM (PROTOPORPHYRIN) x 2


    Google Scholar output for 1io7

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch