The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of human AUH protein, a single-stranded RNA binding homolog of enoyl-CoA hydratase. Structure 9 1253-1263 2001
    Site RSGI
    PDB Id 1hzd Target Id trt001000211.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS14103, Molecular Weight 29194.40 Da.
    Residues 272 Isoelectric Point 9.15
    Sequence ssemktedelrvrhleeenrgivvlginraygknslsknlikmlskavdalksdkkvrtiiirsevpgi fcagadlkerakmsssevgpfvskiravindianlpvptiaaidglalggglelalacdirvaassakm glvetklaiipggggtqrlpraigmslakelifsarvldgkeakavglishvleqnqegdaayrkaldl areflpqgpvamrvaklainqgmevdlvtglaieeacyaqtiptkdrlegllafkekrpprykge
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.20 Rfree 0.2530000
    Matthews' coefficent 2.26 Rfactor 0.2070000
    Waters 309 Solvent Content 53.24

    Ligand Information


    Google Scholar output for 1hzd

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch