.
The Open Protein Structure Annotation Network
PDB Keyword
.

1gln

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Architectures of class-defining and specific domains of glutamyl-tRNA synthetase. Science 267 1958-1965 1995
    Site RSGI
    PDB Id 1gln Target Id ttk003000897.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14482, Molecular Weight 53906.93 Da.
    Residues 468 Isoelectric Point 6.53
    Sequence mvvtriapsptgdphvgtayialfnyawarrnggrfivriedtdraryvpgaeerilaalkwlglsyde gpdvggphgpyrqserlplyqkyaeellkrgwayrafetpeeleqirkekggydgrarnippeeaeera rrgephvirlkvprpgttevkdelrgvvvydnqeipdvvllksdgyptyhlanvvddhlmgvtdvirae ewlvstpihvllyrafgweaprfyhmpllrnpdktkiskrkshtsldwykaegflpealrnylclmgfs mpdgreiftleefiqaftwervslggpvfdleklrwmngkyirevlsleevaervkpflreaglswese aylrravelmrprfdtlkefpekarylftedypvsekaqrkleeglpllkelyprlraqeewteaalea llrgfaaekgvklgqvaqplraaltgsletpglfeilallgkeralrrlerala
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree
    Matthews' coefficent 2.61 Rfactor 0.1850000
    Waters 160 Solvent Content 52.83

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1gln

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch