The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the bacteria-specific L17 ribosomal protein from Thermus thermophilus. To be Published
    Site RSGI
    PDB Id 1gd8 Target Id ttk003000817.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14446, Molecular Weight 13714.32 Da.
    Residues 118 Isoelectric Point 11.36
    Sequence mrhlksgrklnrhsshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdlharrlvlrd lqdvklvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 9
    Resolution (Å) 2.30 Rfree 0.2540000
    Matthews' coefficent 3.11 Rfactor 0.2100000
    Waters 157 Solvent Content 60.39

    Ligand Information


    Google Scholar output for 1gd8

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch