The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the ttCsaA protein: an export-related chaperone from Thermus thermophilus. EMBO J. 20 562-569 2001
    Site RSGI
    PDB Id 1gd7 Target Id ttk003000895.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14480, Molecular Weight 11898.37 Da.
    Residues 109 Isoelectric Point 8.89
    Sequence mtpleafqildlrvgrvlraephekarkpsyklwvdlgplgvkqssaqitelyrpedlvgrlvvcavnl gakrvagflsevlvlgvpdeagrvvllapdrevplggkvf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.00 Rfree 0.2770000
    Matthews' coefficent 2.72 Rfactor 0.2170000
    Waters 328 Solvent Content 54.75

    Ligand Information


    Google Scholar output for 1gd7

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch