.
The Open Protein Structure Annotation Network
PDB Keyword
.

1fex

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of the hRap1 Myb motif reveals a canonical three-helix bundle lacking the positive surface charge typical of Myb DNA-binding domains. J.Mol.Biol. 312 167-175 2001
    Site RSGI
    PDB Id 1fex Target Id trt001000207.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS14101, Molecular Weight 6649.15 Da.
    Residues 59 Isoelectric Point 9.60
    Sequence griaftdaddvailtyvkenarspssvtgnalwkamekssltqhswqslkdrylkhlrg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1fex

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch