The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the Ras-binding domain of RGL. FEBS Lett. 441 413-418 1998
    Site RSGI
    PDB Id 1ef5 Target Id trt001000187.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS14093, Molecular Weight 11726.59 Da.
    Residues 103 Isoelectric Point 4.59
    Sequence sitstvlppvynqqnedtciirisvednngnmyksimltsqdktpaviqramskhnlesdpaeeyelvq visedkelvipdsanvfyamnsqvnfdfilrkkn
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1ef5

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch