.
The Open Protein Structure Annotation Network
PDB Keyword
.

1d8z

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR studies on functional structures of the AU-rich element-binding domains of Hu antigen C. Nucleic Acids Res. 28 1743-1750 2000
    Site RSGI
    PDB Id 1d8z Target Id trt001000201.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS14097, Molecular Weight 9835.60 Da.
    Residues 89 Isoelectric Point 8.76
    Sequence mdsktnlivnylpqnmtqdefkslfgsigdiescklvrdkitgqslgygfvnysdpndadkaintlngl klqtktikvsyarpssasir
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1d8z

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch