The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Thermus thermophilus HB8 UvrB protein, a key enzyme of nucleotide excision repair. J.Biochem.(Tokyo) 126 986-990 1999
    Site RSGI
    PDB Id 1d2m Target Id ttk003000737.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14425, Molecular Weight 76155.92 Da.
    Residues 665 Isoelectric Point 5.55
    Sequence mtfryrgpspkgdqpkaiaglvealrdgerfvtllgatgtgktvtmakviealgrpalvlapnkilaaq laaefrelfpenaveyfisyydyyqpeayvpgkdlyiekdasinpeierlrhsttrslltrrdvivvas vsaiyglgdpreyrarnlvvergkpyprevllerllelgyqrndidlspgrfrakgevleifpayetep irvelfgdeverisqvhpvtgerlrelpgfvlfpathylspegleeilkeiekelwervryfeergevl yaqrlkertlydlemlrvmgtcpgvenyaryftgkapgeppytlldyfpedflvfldeshvtvpqlqgm yrgdyarkktlvdygfrlpsaldnrplrfeeflervsqvvfvsatpgpfelahsgrvveqiirptglld plvrvkptenqildlmegireraargertlvtvltvrmaeeltsflvehgirarylhheldaferqali rdlrlghydclvginllregldipevslvaildadkegflrsersliqtigraarnargevwlyadrvs eamqraieetnrrralqeaynlehgitpetvrkevravirpegyeeapleadlsgedlreriaelelam wqaaealdferaarlrdeiralearlqgvrapepvpggrkrkrr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.253
    Matthews' coefficent 3.68 Rfactor 0.234
    Waters 335 Solvent Content 66.60

    Ligand Information
    Ligands BOG (B-OCTYLGLUCOSIDE) x 3;SO4 (SULFATE) x 1


    Google Scholar output for 1d2m

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch