The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title A helix-turn-helix structure unit in human centromere protein B (CENP-B). EMBO J. 17 827-837 1998
    Site RSGI
    PDB Id 1bw6 Target Id my_001000013.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13676, Molecular Weight 6533.25 Da.
    Residues 56 Isoelectric Point 10.89
    Sequence mgpkrrqltfreksriiqeveenpdlrkgeiarrfnippstlstilknkrailase
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1bw6

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch