The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of Thermus thermophilus HB8 aspartate aminotransferase and its complex with maleate. Biochemistry 38 2413-2424 1999
    Site RSGI
    PDB Id 1bkg Target Id ttk003000021.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14164, Molecular Weight 42048.70 Da.
    Residues 385 Isoelectric Point 6.00
    Sequence mrglsrrvqamkpsatvavnakalelrrqgvdlvaltagepdfdtpehvkeaarralaqgktkyappag ipelrealaekfrrenglsvtpeetivtvggkqalfnlfqaildpgdevivlspywvsypemvrfaggv vvevetlpeegfvpdpervrraitprtkalvvnspnnptgavypkevlealarlavehdfylvsdeiye hllyegehfspgrvapehtltvngaakafamtgwrigyacgpkevikamasvssqsttspdtiaqwatl ealtnqeasrafvemareayrrrrdlllegltalglkavrpsgafyvlmdtspiapdevraaerlleag vavvpgtdfaafghvrlsyatseenlrkalerfarvlgra
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.60 Rfree 0.2380000
    Matthews' coefficent 2.58 Rfactor 0.1970000
    Waters 280 Solvent Content 52.00

    Ligand Information


    Google Scholar output for 1bkg

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch