The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Tm1382, a putative Nudix hydrolase. To be Published
    Site ISFI
    PDB Id 3e57 Target Id ISFI338
    Molecular Characteristics
    Alias Ids TPS27594, Molecular Weight 23076.14 Da.
    Residues 199 Isoelectric Point 4.98
    Sequence mkserilvvktedflkefgefegfmrvnfedflnfldqygffrerdeaeydettkqvipyvvimdgdrv litkrttkqsekrlhnlyslgigghvregdgatpreaflkglerevneevdvslreleflglinsstte vsrvhlgalflgrgkffsvkekdlfewelikleelekfsgvmegwskisaavllnlfltqn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.89 Rfree 0.240
    Matthews' coefficent 2.23 Rfactor 0.199
    Waters 220 Solvent Content 44.74

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information


    Google Scholar output for 3e57

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch