.
The Open Protein Structure Annotation Network
PDB Keyword
.

3d54

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Formylglycinamide ribonucleotide amidotransferase from Thermotoga maritima: structural insights into complex formation. Biochemistry 47 7816-7830 2008
    Site OTHER
    PDB Id 3d54 Target Id PDB3D54
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS25981, TM1245 Molecular Weight 69022.46 Da.
    Residues 629 Isoelectric Point 5.63
    Sequence mgshhhhhhditslykkagsenlyfqmklrylnilkeklgreptfvelqafsvmwsehcgyshtkkyirr lpktgfegnagvvnlddyysvafkieshnhpsaiepyngaatgvggiirdvlamgarptaifdslhmsr iidgiiegiadygnsigvptvggelrisslyahnplvnvlaagvvrndmlvdskasrpgqvivifggat grdgihgasfasedltgdkatklsiqvgdpfaekmlieaflemveeglvegaqdlgaggvlsatselva kgnlgaivhldrvplrepdmepweilisesqermavvtspqkasrileiarkhllfgdvvaevieepvy rvmyrndlvmevpvqllanapeediveytpgkipefkrvefeevnarevfeqydhmvgtdtvvppgfga avmrikrdggyslvthsradlalqdtywgtliavlesvrktlsvgaeplaitncvnygdpdvdpvglsa mmtalknacefsgvpvasgnaslyntyqgkpipptlvvgmlgkvnpqkvakpkpskvfavgwndfeler ekelwrairklseegafilsssqlltrthvetfreyglkievklpevrpahqmvlvfsertpvvdvpvkeigtlsr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 3.50 Rfree 0.282
    Matthews' coefficent Rfactor 0.252
    Waters Solvent Content

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands ADP (ADENOSINE-5'-DIPHOSPHATE) x 3
    Metals NA (SODIUM) x 3

    Jmol

     
    Google Scholar output for 3d54

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch