.
The Open Protein Structure Annotation Network
PDB Keyword
.

3c1y

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural Biochemistry of a Bacterial Checkpoint Protein Reveals Diadenylate Cyclase Activity Regulated by DNA Recombination Intermediates. Mol.Cell 30 167-178 2008
    Site OTHER
    PDB Id 3c1y Target Id PDB3C1Y
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26099, TM0200 Molecular Weight 42700.73 Da.
    Residues 377 Isoelectric Point 6.12
    Sequence mgsshhhhhhssglvprgshmgvkslvpqeliekiklispgtelrkalddiinanfgaliflvddpkkye dviqggfwldtdfsaeklyelskmdgaivlseditkiyyanvhlvpdptiptgetgtrhrtaerlakqt gkvviavsrrrniislyyknykyvvnqvdfliskvtqaistlekykdnfnkllselevlelenrvtlad vvrtlakgfellriveeirpyivelgeegrlarmqlreltedvddllvllimdysseeveeetaqnilq dfitrrepspisisrvlgydvqqaaqlddvlvsargyrllktvariplsigynvvrmfktldqiskasv edlkkvegigekraraisesisslkhrktse
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.257
    Matthews' coefficent 2.86 Rfactor 0.223
    Waters 217 Solvent Content 56.99

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands 2BA ((2R,3R,3AS,5R,7AR,9R,10R,10AS,12R,14AR)-2,9-BIS(6-) x 1
    Metals

    Jmol

     
    Google Scholar output for 3c1y

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch