The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure and Ligand Binding of the Soluble Domain of a Thermotoga Maritima Membrane Protein of Unknown Function Tm1634. Protein Sci. 17 869-877 2008
    Site OTHER
    PDB Id 2vkj Target Id PDB2VKJ
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26108, TM1634 Molecular Weight 12283.49 Da.
    Residues 106 Isoelectric Point 5.58
    Sequence gshmnlavkltrmektlkayelyifsdyenfenyvkkeglkiegmellkekkarsliaegkdlfetanyg ealvffekalnlsdneeikkiasfyleecrkklagd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.65 Rfree 0.229
    Matthews' coefficent 2.3 Rfactor 0.203
    Waters 215 Solvent Content 47

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands SO4 (SULFATE) x 3


    Google Scholar output for 2vkj

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch