.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qpo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Quaternary structure change as a mechanism for the regulation of thymidine kinase 1-like enzymes. Structure 15 1555-1566 2007
    Site OTHER
    PDB Id 2qpo Target Id PDB2QPO
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26077, TM0401 Molecular Weight 20652.83 Da.
    Residues 184 Isoelectric Point 6.95
    Sequence msgkltvitgpmysgkttellsfveiyklgkkkvavfkpkidsryhstmivshsgngveahvierpeemr kyieedtrgvfidevqffnpslfevvkdlldrgidvfcagldlthkqnpfettalllsladtvikkkav chrcgeynatltlkvaggeeeidvggqekyiavcrdcyntlkkrv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.95 Rfree 0.26115
    Matthews' coefficent 1.87 Rfactor 0.20306
    Waters 155 Solvent Content 34.12

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands SO4 (SULFATE) x 4
    Metals ZN (ZINC) x 4

    Jmol

     
    Google Scholar output for 2qpo

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch