.
The Open Protein Structure Annotation Network
PDB Keyword
.

2o7i

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural Analysis of Semi-specific Oligosaccharide Recognition by a Cellulose-binding Protein of Thermotoga maritima Reveals Adaptations for Functional Diversification of the Oligopeptide Periplasmic Binding Protein Fold. J.Biol.Chem. 284 33217-33223 2009
    Site OTHER
    PDB Id 2o7i Target Id PDB2O7I
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26067, TM0031 Molecular Weight 68650.50 Da.
    Residues 592 Isoelectric Point 5.18
    Sequence mqvslpredtvyiggalwgpattwnlyapqstwgtdqfmylpafqydlgrdawipviaeryefvddktlr iyirpearwsdgvpitaddfvyaleltkelgigpgggwdtyieyvkavdtkvvefkakeenlnyfqfls yslgaqpmpkhvyeriraqmnikdwindkpeeqvvsgpyklyyydpnivvyqrvddwwgkdifglprpk ylahviykdnpsaslafergdidwnglfipsvwelwekkglpvgtwykkepyfipdgvgfvyvnntkpg lsdpavrkaiayaipynemlkkayfgygsqahpsmvidlfepykqyidyelakktfgtedgripfdldm ankildeagykkgpdgvrvgpdgtklgpytisvpygwtdwmmmcemiaknlrsigidvktefpdfsvwa drmtkgtfdliiswsvgpsfdhpfniyrfvldkrlskpvgevtwagdwerydndevvelldkavstldp evrkqayfriqqiiyrdmpsipafytahwyeystkywinwpsednpawfrpspwhadawptlfiiskks dpqpvpswlgtvdeggieiptakifedlqkatmhhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.216
    Matthews' coefficent 2.46 Rfactor 0.192
    Waters 500 Solvent Content 50.02

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands CBI (CELLOBIOSE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2o7i

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch