.
The Open Protein Structure Annotation Network
PDB Keyword
.

2nrt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the C-terminal half of UvrC reveals an RNase H endonuclease domain with an Argonaute-like catalytic triad. Embo J. 26 613-622 2007
    Site OTHER
    PDB Id 2nrt Target Id PDB2NRT
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26083, TM0265 Molecular Weight 25336.98 Da.
    Residues 220 Isoelectric Point 9.19
    Sequence mrglrkealeelmkllnmkdfpyriegidishlqgkytvaslvvfedgfpkkgdyrrykieqdhpddyes irtvvkrryskhplpnllfvdggigqvnaaiealkeigkdcpvvglakkeetvvfenreihlphdhpvl rllvqirdethrfavsyhrkrrekeslrsvldnvpgigpirkkkliehfgslenirsasleeiarvigs teiarrvldilg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.221
    Matthews' coefficent 2.33 Rfactor 0.185
    Waters 206 Solvent Content 47.22

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 5

    Jmol

     
    Google Scholar output for 2nrt

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch