.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hp7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of FliM provides insight into assembly of the switch complex in the bacterial flagella motor. Proc.Natl.Acad.Sci.Usa 103 11886-11891 2006
    Site OTHER
    PDB Id 2hp7 Target Id PDB2HP7
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS19982, TM0679 Molecular Weight 21030.15 Da.
    Residues 183 Isoelectric Point 4.47
    Sequence pskfskeqlrtfqmihenfgralstylsgrlrtfvdveisidqltyeefirsvmipsfiviftgdvfegs aifemrldlfytmldiimggpgenppnrppteietsimrkevtnmltllaqawsdfqyfipsienvetn pqfvqivppneivllvtasvswgeftsfinvcwpfsllepllek
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.249
    Matthews' coefficent 2.20 Rfactor 0.224
    Waters 190 Solvent Content 44.05

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2hp7

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch