.
The Open Protein Structure Annotation Network
PDB Keyword
.

2h3h

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure-based design of robust glucose biosensors using a Thermotoga maritima periplasmic glucose-binding protein. Protein Sci. 16 2240-2250 2007
    Site OTHER
    PDB Id 2h3h Target Id PDB2H3H
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26063, TM0114 Molecular Weight 33865.38 Da.
    Residues 313 Isoelectric Point 5.38
    Sequence mltigvigksvhpywsqveqgvkaagkalgvdtkffvpqkedinaqlqmlesfiaegvngiaiapsdpta viptikkalemgipvvtldtdspdsgryvyigtdnyqagytaglimkellggkgkvvigtgsltamnsl qriqgfkdaikdseieivdilndeedgaravslaeaalnahpdldaffgvyayngpaqalvvknagkvg kvkivcfdttpdilqyvkegviqatmgqrpymmgylsvtvlylmnkigvqntlmmlpkvkvdgkvdyvi dtgvdvvtpenldeylkkmeelgipikfgshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.24108
    Matthews' coefficent 2.83 Rfactor 0.20306
    Waters 668 Solvent Content 56.53

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands BGC (BETA-D-GLUCOSE) x 2
    Metals

    Jmol

     
    Google Scholar output for 2h3h

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch