.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gtd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a Type III Pantothenate Kinase: Insight into the Mechanism of an Essential Coenzyme A Biosynthetic Enzyme Universally Distributed in Bacteria. J.Bacteriol. 188 5532-5540 2006
    Site OTHER
    PDB Id 2gtd Target Id PDB2GTD
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS18722, TM0883 Molecular Weight 27624.50 Da.
    Residues 251 Isoelectric Point 6.00
    Sequence gamdpmyllvdvgnthsvfsitedgktfrrwrlstgvfqtedelfshlhpllgdamreikgigvasvvpt qntvierfsqkyfhispiwvkakngcvkwnvknpsevgadrvanvvafvkeygkngiiidmgtattvdl vvngsyeggailpgffmmvhslfrgtaklplvevkpadfvvgkdteenirlgvvngsvyalegiigrik evygdlpvvltggqskivkdmikheifdedltikgvyhfcfgd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.00 Rfree 0.245
    Matthews' coefficent 2.23 Rfactor 0.188
    Waters 1345 Solvent Content 44.93

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2gtd

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch