.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fnc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of redundant maltotriose binding proteins from the thermophile Thermotoga maritima. To be Published
    Site OTHER
    PDB Id 2fnc Target Id PDB2FNC
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS26075, TM1839 Molecular Weight 41787.93 Da.
    Residues 381 Isoelectric Point 5.16
    Sequence mkltiwcsekqvdilqklgeefkakygipvevqyvdfgsikskfltaapqgqgadiivgahdwvgelavn gliepipnfsdlknfydtalkafsyggklygvpyameavaliynkdyvdsvpktmdeliekakqideey ggevrgfiydvanfyfsapfilgyggyvfketpqgldvtdiglanegavkgaklikrmidegvltpgdn ygtmdsmfkeglaamiinglwaiksykdaginygvapipelepgvpakpfvgvqgfminakspnkviam efltnfiarketmykiyladprlparkdvlelvkdnpdvvaftqsasmgtpmpnvpemapvwsamgdal siiingqasvedalkeavekikaqiekgshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.23
    Matthews' coefficent 2.13 Rfactor 0.194
    Waters 330 Solvent Content 42.21

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands MLR (MALTOTRIOSE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2fnc

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch