.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ce7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Molecular Architecture of the Metalloprotease Ftsh. Proc.Natl.Acad.Sci.USA 103 3066 2006
    Site OTHER
    PDB Id 2ce7 Target Id PDB2CE7
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS19974, TM0580 Molecular Weight 52672.59 Da.
    Residues 476 Isoelectric Point 5.71
    Sequence matmykpsgnkrvtfkdvggaeeaieelkevveflkdpskfnrigarmpkgillvgppgtgktllarava geanvpffhisgsdfvelfvgvgaarvrdlfaqakahapcivfideidavgrhrgaglggghdereqtl nqllvemdgfdskegiivmaatnrpdildpallrpgrfdkkivvdppdmlgrkkileihtrnkplaedv nleiiakrtpgfvgadlenlvneaallaaregrdkitmkdfeeaidrviagparksllispaekriiay heaghavvstvvpngepvhrisiiprgykalgytlhlpeedkylvsrnelldkltallggraaeevvfg dvtsgaandierateiarnmvcqlgmseelgplawgkeeqevflgkeitrlrnyseevaskideevkki vtncyerakeiirkyrkqldniveilleketiegdelrrilseefekvveaaalehhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.44 Rfree 0.269
    Matthews' coefficent 2.8 Rfactor 0.222
    Waters 199 Solvent Content 54

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands ADP (ADENOSINE-5'-DIPHOSPHATE) x 6
    Metals MG (MAGNESIUM) x 6;ZN (ZINC) x 6

    Jmol

     
    Google Scholar output for 2ce7

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch