.
The Open Protein Structure Annotation Network
PDB Keyword
.

2b5d

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the novel alpha-amylase AmyC from Thermotoga maritima. Acta Crystallogr.,Sect.D 62 262-270 2006
    Site OTHER
    PDB Id 2b5d Target Id PDB2B5D
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS20006, TM1438 Molecular Weight 62856.59 Da.
    Residues 528 Isoelectric Point 5.47
    Sequence mrgkiliflhahlpyvhhpeydhfleerwlfeaitetyipllmmfdeiedfrltmsitpplmemlssrdl qekyerhmeklielankevertkkehplkhkmakfyrehfekilnvfrsydgnilegfkkyqetgklei vtcnathaflplyqmypevvnaqitvgvknyekhmkkhprgiwlaecgyyqgldlylaqnnveyffvds hafwfadeqprygvyrpimtpsgvfafardpesseqvwsaavgypgdpryrefyrdigfdremeyikdy idpsgvrintgikyhritsksldasqkeyydidlameaveehardflhkkesqarrlmdimgvepviva pfdaelfghwwfegvfflkrffelvneskdlklvtasevidtleevqiatpadsswgaggyyetwlngt ndwiyrhlhemiermidlskkyynssdplvervlnqmlrelflaqssdwafimttrtsvqyaenrtklh ikrflnlydqlvsgrideemlryyewtdaifpeinfrvmardvi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.25709
    Matthews' coefficent 4.10 Rfactor 0.21945
    Waters 317 Solvent Content 70.00

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2b5d

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch