The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a hyperthermostable subfamily II isocitrate dehydrogenase from Thermotoga maritima. Febs J. 273 2851-2868 2006
    Site OTHER
    PDB Id 1zor Target Id PDB1ZOR
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS18718, TM1148 Molecular Weight 45400.27 Da.
    Residues 399 Isoelectric Point 7.02
    Sequence mekvkvknpiveldgdemarvmwkmikeklilpyldiqlvyfdlgikkrdetddqitieaakaikkygvg vkcatitpdaervkeynlkkawkspnatirayldgtvfrkpimvknvpplvkrwkkpiiigrhaygdiy naveakvegpaevelvvrnkenktllvhkfegngvvmamhnleksirsfaqscinyaisekvdiwfatk dtiskvyhayfkdifqeevdkrkeelekagvnyrymliddaaaqilrseggmlwacmnyegdimsdmia sgfgslglmtsvlvspdgvyefeaahgtvrrhyyrylkgektstnptasifawtgairkrgeldgtpev cefadklekavintiesgvitkdlqpfteppidkyvtleefidevkknlekll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.24 Rfree 0.22317
    Matthews' coefficent 2.70 Rfactor 0.18449
    Waters 428 Solvent Content 54.80

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Metals NA (SODIUM) x 2


    Google Scholar output for 1zor

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch