.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ycz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural insights into the first incision reaction during nucleotide excision repair. Embo J. 24 885-894 2005
    Site OTHER
    PDB Id 1ycz
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS19966, Molecular Weight 11356.78 Da.
    Residues 96 Isoelectric Point 9.69
    Sequence mkekirkkillapeepgvyifknkgvpiyigkakrlsnrlrsylnpqtekvfrigeeadeletivvmner eafileanlikkyrpkynvrlkdtdf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.19903
    Matthews' coefficent 3.65 Rfactor 0.18504
    Waters 101 Solvent Content 66.35

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 1ycz

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch